Follow young Cora’s journey as she makes a desperate bid for freedom in the antebellum South. After escaping her Georgia plantation for the rumored Underground Railroad, Cora discovers no mere…

Fourdiehardfishermenaredeterminedtobethefirsttofishthemostremotewatersleftonearth.Alongtheway,theywillbattletheelements,dodgedrugcartelsandendurehell,astheyrisktheirlivesinanattempttolivetheirdream.

This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…

The League of Gentlemen is a British comedy television series that premiered on BBC Two in 1999. The show is set in Royston Vasey, a fictional town in Northern England…

It’s been a few years, and there’s still not a lot going on in Dog River, 40 kilometres from nowhere. But that’s all about to change.

Documentary series telling the story of some of Britain’s most high-profile murder cases.

Andrea is a seemingly confident comedy writer, wife and mom, who comically exposes her inner immaturity and neuroses through unexpected life situations.

Taj,Taryll,andTJJacksonstruggletomanagetheirlives,careersandfamiliesundertheconstantspotlightoftheirfamouslastname.

Bruce Campbell reprises his role as Ash Williams, an aging lothario and chainsaw-handed monster hunter who’s spent the last three decades avoiding maturity, and the terrors of the Evil Dead….

Some of Australia’s most opinionated and avid TV viewers comment on the best, worst and controversial shows and news stories of the past week, from the comfort of their sofas.

Thousands of years in the future, a city known as “Eden 3” is inhabited solely by robots whose former masters vanished a long time ago. On a routine assignment, two…

After a family member is murdered, con woman Silvia decides to get even by robbing the crime boss behind the hit. But things go awry, and she has to flee…